HTML SitemapExplore

STONEWALLS — Restaurant in Marco Island

Name
STONEWALLS
Description
Contemporary order-at-the-counter eatery offering gourmet flatbreads, sandwiches & breakfast fare.
Nearby attractions
Marco Island Center for the Arts
1010 Winterberry Dr, Marco Island, FL 34145
Marco Eco Tours: Kayak Tours & Rentals
291 S Collier Blvd UNIT 201, Marco Island, FL 34145
Nearby restaurants
Marco Prime Steak & Seafood Restaurant
599 S Collier Blvd, Marco Island, FL 34145
The Oyster Society
599 S Collier Blvd #218, Marco Island, FL 34145, United States
Nacho Mama's.
599 S Collier Blvd, Marco Island, FL 34145
DaVinci's
599 S Collier Blvd #215, Marco Island, FL 34145
2Shea's Salty Dog
599 S Collier Blvd # 105, Marco Island, FL 34145
The Deck at 560
560 S Collier Blvd, Marco Island, FL 34145, United States
Pinchers
591 S Collier Blvd, Marco Island, FL 34145
Dolce Mare
599 S Collier Blvd Suite 302, Marco Island, FL 34145
Beebe's Ice Cream
599 S Collier Blvd, Marco Island, FL 34145
La Tavola Restaurant and Bar
961 Winterberry Dr, Marco Island, FL 34145
Nearby local services
Marco Walk Plaza
599 S Collier Blvd, Marco Island, FL 34145
LivingStyles Interiors
561 S Collier Blvd, Marco Island, FL 34145, United States
· [Shore · Goods] ·
599 S Collier Blvd UNIT 315, Marco Island, FL 34145
Marco Escapes - Marco Island Vacation Rentals
599 S Collier Blvd Suite 115, Marco Island, FL 34145
Marco Golf And Garden
971 Winterberry Dr, Marco Island, FL 34145
Chico's
599 S Collier Blvd Ste 311, Marco Island, FL 34145
Marco Island Water Sports
600 S Collier Blvd, Marco Island, FL 34145
Sunsations
671 S Collier Blvd, Marco Island, FL 34145
Sunshine Booksellers South
677 S Collier Blvd, Marco Island, FL 34145
Spa by JW at JW Marriott Marco Island
400 S Collier Blvd, Marco Island, FL 34145
Nearby hotels
Hilton Marco Island Beach Resort and Spa
560 S Collier Blvd, Marco Island, FL 34145
Marco Beach Ocean Resort
480 S Collier Blvd, Marco Island, FL 34145, United States
The Surf Club of Marco Resort, a Hilton Grand Vacations Club
540 S Collier Blvd, Marco Island, FL 34145
Marriott's Crystal Shores
600 S Collier Blvd, Marco Island, FL 34145
Eagle's Nest Beach Resort, a Hilton Grand Vacations Club
410 S Collier Blvd, Marco Island, FL 34145
JW Marriott Marco Island Beach Resort
400 S Collier Blvd, Marco Island, FL 34145
Marco Island
500 S Collier Blvd, Marco Island, FL 34145
Marco Island
500 S Collier Blvd, Marco Island, FL 34145
Sandcastle
730 S Collier Blvd, Marco Island, FL 34145, United States
Related posts
Keywords
STONEWALLS tourism.STONEWALLS hotels.STONEWALLS bed and breakfast. flights to STONEWALLS.STONEWALLS attractions.STONEWALLS restaurants.STONEWALLS local services.STONEWALLS travel.STONEWALLS travel guide.STONEWALLS travel blog.STONEWALLS pictures.STONEWALLS photos.STONEWALLS travel tips.STONEWALLS maps.STONEWALLS things to do.
STONEWALLS things to do, attractions, restaurants, events info and trip planning
STONEWALLS
United StatesFloridaMarco IslandSTONEWALLS

Basic Info

STONEWALLS

551 S Collier Blvd, Marco Island, FL 34145
4.4(664)$$$$
Closed
order
order
Order
delivery
Save
spot

Ratings & Description

Info

Contemporary order-at-the-counter eatery offering gourmet flatbreads, sandwiches & breakfast fare.

attractions: Marco Island Center for the Arts, Marco Eco Tours: Kayak Tours & Rentals, restaurants: Marco Prime Steak & Seafood Restaurant, The Oyster Society, Nacho Mama's., DaVinci's, 2Shea's Salty Dog, The Deck at 560, Pinchers, Dolce Mare, Beebe's Ice Cream, La Tavola Restaurant and Bar, local businesses: Marco Walk Plaza, LivingStyles Interiors, · [Shore · Goods] ·, Marco Escapes - Marco Island Vacation Rentals, Marco Golf And Garden, Chico's, Marco Island Water Sports, Sunsations, Sunshine Booksellers South, Spa by JW at JW Marriott Marco Island
logoLearn more insights from Wanderboat AI.
Phone
(239) 389-1995
Website
marcostonewalls.com
Open hoursSee all hours
Tue8:30 AM - 8 PMClosed

Plan your stay

hotel
Pet-friendly Hotels in Marco Island
Find a cozy hotel nearby and make it a full experience.
hotel
Affordable Hotels in Marco Island
Find a cozy hotel nearby and make it a full experience.
hotel
The Coolest Hotels You Haven't Heard Of (Yet)
Find a cozy hotel nearby and make it a full experience.
hotel
Trending Stays Worth the Hype in Marco Island
Find a cozy hotel nearby and make it a full experience.

Featured dishes

View full menu
dish
Islander Breakfast
dish
Egg & Cheese Sandwich
dish
Biscuits & Gravy
dish
Steak And Eggs
dish
Huevos A La Mexicana
dish
Eggs Benedict
dish
Veggie Benedict
dish
Prosciutto Benedict
dish
Mexican Skillet
dish
Veggie Skillet
dish
Corned Beef Skillet
dish
Classic Oatmeal
dish
Avocado Toast
dish
Smoked Salmon Bagel
dish
Yogurt Parfait
dish
Belgian Waffle
dish
Fruit Waffle
dish
Strawberry Waffle
dish
DOUBLE CHOCOLATE WAFFLE
dish
Crunchy French Toast
dish
Canoli Stuffed French Toast
dish
French Toast
dish
Stonewalls Pancakes
dish
Ham And Cheese Omelette
dish
Veggie Omelette
dish
Stonewall Omelette
dish
Italian Omelette
dish
Greek Omelette
dish
Meat Lovers Omelette
dish
The White Omelet
dish
Create Your Own Omelette
dish
Side Of Meat
dish
1 Pancake

Reviews

Live events

Scenic Naples Tour by Segway Electric Bike
Scenic Naples Tour by Segway Electric Bike
Tue, Feb 24 • 9:00 AM
Naples, Florida, 34102
View details
Build a dock scene from lobster traps
Build a dock scene from lobster traps
Tue, Feb 24 • 11:30 AM
Naples, Florida, 34102, United States
View details
Naples Murder Mystery 2: Crime on Date Night!
Naples Murder Mystery 2: Crime on Date Night!
Sun, Feb 1 • 12:00 AM
585 6th Ave S, Naples, FL, 34102
View details

Nearby attractions of STONEWALLS

Marco Island Center for the Arts

Marco Eco Tours: Kayak Tours & Rentals

Marco Island Center for the Arts

Marco Island Center for the Arts

4.7

(19)

Closed
Click for details
Marco Eco Tours: Kayak Tours & Rentals

Marco Eco Tours: Kayak Tours & Rentals

5.0

(463)

Closed
Click for details

Nearby restaurants of STONEWALLS

Marco Prime Steak & Seafood Restaurant

The Oyster Society

Nacho Mama's.

DaVinci's

2Shea's Salty Dog

The Deck at 560

Pinchers

Dolce Mare

Beebe's Ice Cream

La Tavola Restaurant and Bar

Marco Prime Steak & Seafood Restaurant

Marco Prime Steak & Seafood Restaurant

4.4

(620)

$$$

Closed
Click for details
The Oyster Society

The Oyster Society

4.6

(685)

$$$

Closed
Click for details
Nacho Mama's.

Nacho Mama's.

3.7

(484)

$$

Closed
Click for details
DaVinci's

DaVinci's

4.7

(894)

$$

Closed
Click for details

Nearby local services of STONEWALLS

Marco Walk Plaza

LivingStyles Interiors

· [Shore · Goods] ·

Marco Escapes - Marco Island Vacation Rentals

Marco Golf And Garden

Chico's

Marco Island Water Sports

Sunsations

Sunshine Booksellers South

Spa by JW at JW Marriott Marco Island

Marco Walk Plaza

Marco Walk Plaza

4.6

(424)

Click for details
LivingStyles Interiors

LivingStyles Interiors

4.4

(11)

Click for details
· [Shore · Goods] ·

· [Shore · Goods] ·

4.8

(59)

Click for details
Marco Escapes - Marco Island Vacation Rentals

Marco Escapes - Marco Island Vacation Rentals

4.6

(75)

Click for details
Get the Appoverlay
Get the AppOne tap to find yournext favorite spots!
Wanderboat LogoWanderboat

Your everyday Al companion for getaway ideas

CompanyAbout Us
InformationAI Trip PlannerSitemap
SocialXInstagramTiktokLinkedin
LegalTerms of ServicePrivacy Policy

Get the app

© 2025 Wanderboat. All rights reserved.

Posts

Your browser does not support the video tag.
mywalksinparadisemywalksinparadise
Stonewalls A Modern American Eatery. Filmed 4/17/24. It’s a simple concept, you order your own food and they bring it out to you. Go to mywalksinparadise.com for more. #Stonewalls #Breakfast #EggsBenedict#FYP #MarcoIsland #mywalksinparadise #4K
Your browser does not support the video tag.
stonewallsofmarcostonewallsofmarco
Welcome to our restaurant Stonewalls! We’re excited to serve you delicious meals and unforgettable experiences. Come dine with us and feel at home 🫶🏼 #stonewalls#marcoislandflorida#floridalife##breakfast#options#yummyfood #foryou #fy
Nello TropsNello Trops
I didn’t know what to expect I just stopped at this restaurant without looking at reviews and stuff the exterior looked very clean and inviting. I was pleased by the courtesy of the staff and easy ordering at the counter, you must order your food at the counter wasn’t used to that system but worked out nice and smooth. I was pleased with pricing was very reasonable for a family of five I’m used to getting hammered every time but not at this place. Once we received the food it was delicious all the plates we ordered tasted good , I mean pasta, some protein and seafood all were good I was surprised , sometimes a restaurant could specialize in protein for example but these guys all was good and tasty. I would definitely go back on my next trip to Marco Island.
See more posts
See more posts
hotel
Find your stay

Pet-friendly Hotels in Marco Island

Find a cozy hotel nearby and make it a full experience.

Stonewalls A Modern American Eatery. Filmed 4/17/24. It’s a simple concept, you order your own food and they bring it out to you. Go to mywalksinparadise.com for more. #Stonewalls #Breakfast #EggsBenedict#FYP #MarcoIsland #mywalksinparadise #4K
mywalksinparadise

mywalksinparadise

hotel
Find your stay

Affordable Hotels in Marco Island

Find a cozy hotel nearby and make it a full experience.

Get the Appoverlay
Get the AppOne tap to find yournext favorite spots!
Welcome to our restaurant Stonewalls! We’re excited to serve you delicious meals and unforgettable experiences. Come dine with us and feel at home 🫶🏼 #stonewalls#marcoislandflorida#floridalife##breakfast#options#yummyfood #foryou #fy
stonewallsofmarco

stonewallsofmarco

hotel
Find your stay

The Coolest Hotels You Haven't Heard Of (Yet)

Find a cozy hotel nearby and make it a full experience.

hotel
Find your stay

Trending Stays Worth the Hype in Marco Island

Find a cozy hotel nearby and make it a full experience.

I didn’t know what to expect I just stopped at this restaurant without looking at reviews and stuff the exterior looked very clean and inviting. I was pleased by the courtesy of the staff and easy ordering at the counter, you must order your food at the counter wasn’t used to that system but worked out nice and smooth. I was pleased with pricing was very reasonable for a family of five I’m used to getting hammered every time but not at this place. Once we received the food it was delicious all the plates we ordered tasted good , I mean pasta, some protein and seafood all were good I was surprised , sometimes a restaurant could specialize in protein for example but these guys all was good and tasty. I would definitely go back on my next trip to Marco Island.
Nello Trops

Nello Trops

See more posts
See more posts

Reviews of STONEWALLS

4.4
(664)
avatar
2.0
4y

This review is not ill-intended or to tarnish a business. I don’t leave reviews ever, for anything. We’ve been eyeing this place for the 4 days we’ve been here. It’s across from our hotel and super convenient. The reviews for the most part are wonderful. So we were so excited to try this place. We noticed the parking lot was empty all nights we were here which we thought was strange if it’s rated so well, but gave it a shot anyway.. We reviewed the menu before arriving to be familiar with what they have to offer. When you first walk in, a giant digital menu greets you to choose from. I noticed right away it was much smaller than their menu online. That was off putting but we each found something. When you go to pay at the register, there’s a small laminated menu right in front that is the FULL menu. I asked them if that’s the full menu that’s available and I wasn’t answered, just stared at. So we just ordered what we had already found. You seat yourself after ordering at their counter. One thing I will say I noticed, is the menu is kind of all over the place. There really isn’t a similar item to another on there. It ranges greatly, which made me a little curious. Anywho, we got our food (pizza for the kids, chicken pot pie for myself, grouper francesse for hubby). Kids ate the pizza, which appeared to be a frozen one heated up. The chicken pot pie was super underwhelming, which I was so excited to try. It had no flavor and just completely lacked. Husbands grouper had some sort of lemon butter/white wine sauce that was almost in a gelatin form, he was very put off from it, and he’s not picky whatsoever, so that kind of sealed the deal right then. I guess overall we were just truly surprised as the reviews are so wonderful here. The flavor is just not there at all sadly. $75 wasted. I had a short chat with what I think was the owner, and he was such a sweet man. You can tell he cares about his customers. I just wish the food had more to offer. Or maybe we just had a terribly unlucky day? Just wanted to warn others in case they are chancing it based on...

   Read more
avatar
2.0
4y

Stonewalls used to be our go-to place for lunch and dinner when the previous owner, Kim, managed the restaurant. But after it was sold, the restaurant is not the same. The staff is not friendly, and they seem to have changed the ingredients in some of the recipes to lower quality alternatives. They used to have a great supreme pizza, but they change the ingredients, and it doesn’t taste nearly as good. Also, the bread they serve at the table used to be fantastic, but no longer. So, the food doesn’t taste the same.

Also, they started getting skimpy on things, including the side dishes and the drinks. They give you unlimited soft drinks in the tiniest cups imaginable. If you want a larger cup, they will charge you quite a bit extra. I am not sure what the point is, making restaurant patrons get up from their seats multiple times through the meal to refill these tiny cups.

It’s sad to see a restaurant change, especially for the worst. We used to love this restaurant. It was like a second kitchen to us. We were there at least three or four times a week. But now, we never go back. And I a doubt that they would care. They do a brisk business because of their location next to tourist destinations and hotels, not because of their service or food quality. They do have a very wide selection of meal choices that would satisfy anyone in your party, so for that I would give...

   Read more
avatar
2.0
1y

We ate there on December 2, 2024. We always drove by and it looks like such a cute place. Upon entering. It was very bare bones. Some seat cushions were missing and they stuck some other type of cushions on the wood. They use really weird blue, gray lightbulbs and it’s sort of depressing. There are no flowers on the table, just salt and pepper and maybe some ketchup. there is nothing on the walls, but some mirrors and the ambience is a zero. The servers were not great either. My husband ordered the taco salad. It was missing the avocado, and the ranch dressing. When we brought it to the attention of the waitress, she said oh it doesn’t come with avocados and I said well it’s on the menu. Then she said well it’s not included anymore. She said that the ranch dressing was “in there. “No it wasn’t. They finally brought a little dish of sliced avocado and two containers of ranch dressing. So they’ve got terrible ambience, terrible wait staff and the food was just not good. Something is off here And someone needs to get in charge because there’s a lot of restaurants in Marco and this one looks like...

   Read more
Page 1 of 7
Previous
Next