HTML SitemapExplore

The French Workshop — Restaurant in New York

Name
The French Workshop
Description
Popular gourmet bakery offering housemade pastries, breads & espresso drinks in a stylish interior.
Nearby attractions
Crocheron Park
214-41 34th Ave, Bayside, NY 11361
Queens Public Library at Bayside
214-20 Northern Blvd, Bayside, NY 11361
Buz O'Rourke Playground
214-93, 214-31 34th Ave, Bayside, NY 11361
Marie Curie Playground
Q64H+Q9, 209-57A 46th Ave, Bayside, NY 11361
Raymond O'Connor Park
32nd Ave &, Corporal Kennedy St, Bayside, NY 11361
Nearby restaurants
KYURAMEN - Bayside
38-35 Bell Blvd, Bayside, NY 11361
Avli the little Greek tavern
38-31 Bell Blvd, Bayside, NY 11361, United States
Mad For Chicken Bayside
39-02 Bell Blvd, Bayside, NY 11361
Phở Grand Bayside
38-40 Bell Blvd, Bayside, NY 11361
Taverna Kyclades Bayside
39-28 Bell Blvd, Bayside, NY 11361
Maria's Mediterranean
38-11 Bell Blvd, Bayside, NY 11361
Ayna Agra
213-35 39th Ave, Bayside, NY 11361
Kungfu Hot Pot
39-13 Bell Blvd, Bayside, NY 11361
Belly Cake Pancake House
38-36 Bell Blvd, Bayside, NY 11361
Moho Mexican Grill
38-05 Bell Blvd, Bayside, NY 11361
Nearby hotels
Related posts
Keywords
The French Workshop tourism.The French Workshop hotels.The French Workshop bed and breakfast. flights to The French Workshop.The French Workshop attractions.The French Workshop restaurants.The French Workshop travel.The French Workshop travel guide.The French Workshop travel blog.The French Workshop pictures.The French Workshop photos.The French Workshop travel tips.The French Workshop maps.The French Workshop things to do.
The French Workshop things to do, attractions, restaurants, events info and trip planning
The French Workshop
United StatesNew YorkNew YorkThe French Workshop

Basic Info

The French Workshop

38-39 Bell Blvd, Bayside, NY 11361
4.5(1.2K)
order
order
Order
delivery
Save
spot

Ratings & Description

Info

Popular gourmet bakery offering housemade pastries, breads & espresso drinks in a stylish interior.

attractions: Crocheron Park, Queens Public Library at Bayside, Buz O'Rourke Playground, Marie Curie Playground, Raymond O'Connor Park, restaurants: KYURAMEN - Bayside, Avli the little Greek tavern, Mad For Chicken Bayside, Phở Grand Bayside, Taverna Kyclades Bayside, Maria's Mediterranean, Ayna Agra, Kungfu Hot Pot, Belly Cake Pancake House, Moho Mexican Grill
logoLearn more insights from Wanderboat AI.
Phone
(718) 224-0700
Website
thefrenchworkshop.com

Plan your stay

hotel
Pet-friendly Hotels in New York
Find a cozy hotel nearby and make it a full experience.
hotel
Affordable Hotels in New York
Find a cozy hotel nearby and make it a full experience.
hotel
The Coolest Hotels You Haven't Heard Of (Yet)
Find a cozy hotel nearby and make it a full experience.
hotel
Trending Stays Worth the Hype in New York
Find a cozy hotel nearby and make it a full experience.

Featured dishes

View full menu
STRAWBERRY FRUIT TART
Sable biscuit with Madagascan vanilla crĂšme patisserie and fresh strawberries.
RASPBERRY FRUIT TART
Sablé biscuit with Madagascan vanilla crÚme patisserie and fresh raspberries.
BLUEBERRY FRUIT TART
Sablé biscuit with Madagascan vanilla crÚme patisserie and fresh blueberries.
CHOCOLATE TART
Sablé biscuit with dark chocolate ganache and a layer of feuilletine with praline paste, topped with dark chocolate glaze.
LEMON MERINGUE TART
Sablé biscuit with lemon curd, dacquoise sponge insert and Italian meringue

Reviews

Nearby attractions of The French Workshop

Crocheron Park

Queens Public Library at Bayside

Buz O'Rourke Playground

Marie Curie Playground

Raymond O'Connor Park

Crocheron Park

Crocheron Park

4.6

(766)

Open 24 hours
Click for details
Queens Public Library at Bayside

Queens Public Library at Bayside

4.3

(56)

Open 24 hours
Click for details
Buz O'Rourke Playground

Buz O'Rourke Playground

4.3

(19)

Open 24 hours
Click for details
Marie Curie Playground

Marie Curie Playground

4.5

(217)

Open 24 hours
Click for details

Things to do nearby

The Full-Day See It All NYC Tour
The Full-Day See It All NYC Tour
Fri, Jan 9 ‱ 9:00 AM
New York, New York, 10019
View details
The Brooklyn Way
The Brooklyn Way
Mon, Jan 12 ‱ 3:00 PM
Brooklyn, New York, 11201
View details
Maxs Wake n’ Bake Tour
Maxs Wake n’ Bake Tour
Fri, Jan 9 ‱ 11:00 AM
New York, New York, 10025
View details

Nearby restaurants of The French Workshop

KYURAMEN - Bayside

Avli the little Greek tavern

Mad For Chicken Bayside

Phở Grand Bayside

Taverna Kyclades Bayside

Maria's Mediterranean

Ayna Agra

Kungfu Hot Pot

Belly Cake Pancake House

Moho Mexican Grill

KYURAMEN - Bayside

KYURAMEN - Bayside

4.5

(620)

$$

Click for details
Avli the little Greek tavern

Avli the little Greek tavern

4.5

(363)

$$

Click for details
Mad For Chicken Bayside

Mad For Chicken Bayside

4.1

(426)

$$

Click for details
Phở Grand Bayside

Phở Grand Bayside

4.1

(302)

Click for details
Get the Appoverlay
Get the AppOne tap to find yournext favorite spots!
Wanderboat LogoWanderboat

Your everyday Al companion for getaway ideas

CompanyAbout Us
InformationAI Trip PlannerSitemap
SocialXInstagramTiktokLinkedin
LegalTerms of ServicePrivacy Policy

Get the app

© 2025 Wanderboat. All rights reserved.

Reviews of The French Workshop

4.5
(1,240)
avatar
5.0
2y

I am thrilled to give The French Workshop a well-deserved five-star rating after indulging in a delectable journey through the flavors of France that transported me to the streets of Paris. This charming bakery consistently impresses me with its authentic French pastries, inviting ambiance, and exceptional service.

One of the standout features of The French Workshop is its commitment to delivering the genuine taste of France. Each pastry is a work of art, meticulously crafted with a dedication to using traditional recipes and high-quality ingredients. From the buttery croissants to the exquisite éclairs and delicate macarons, every bite is a symphony of flavors that pays homage to the rich heritage of French baking.

The ambiance at The French Workshop is cozy and reminiscent of a quaint Parisian café. The charming decor, combined with the aroma of freshly baked treats, creates an atmosphere that captures the essence of French indulgence. The attention to detail in the presentation adds to the overall charm, making it a place where I can truly savor my pastry.

Customer service at The French Workshop is consistently attentive and friendly. The staff members are knowledgeable about the pastries and eager to assist with recommendations based on individual preferences. Their passion for the authentic flavors they serve is evident in their interactions with customers, enhancing the overall experience.

The menu diversity at The French Workshop is commendable. Beyond the delectable pastries, the bakery often offers a variety of options, from savory quiches to classic French sandwiches. The attention to taste and authenticity extends to every item, ensuring that patrons have a delightful array of choices.

The French Workshop often adds an extra layer of excitement to the experience. Seasonal specials, themed events, and creative collaborations elevate each visit, making it a memorable and engaging pastry-filled journey.

In conclusion, The French Workshop consistently wows me with its authentic pastries, charming ambiance, and exceptional service. It's a culinary haven that brings the flavors of France to life. Whether you're a connoisseur of French baking, a lover of Parisian vibes, or simply in search of a delightful treat, The French Workshop promises an unforgettable experience that easily earns my enthusiastic...

   Read more
avatar
2.0
1y

I don't usually like to write reviews but when you come to pay for good quality food they should provide that quality with the quantity for what they charge. The reason why 2 stars is because when I ordered 3 types of sandwiches, one with chicken another with honey turkey and the other with salmon smoke fish. I asked to cut on each sandwich to 3 slices because it was three of us and we wanted to share it and the staff told me they can't but only can cut 2 slices plus I have to ask manager's permission.. really what is that some kind of kindergarten rules.. So I didn't go further with this nonesense and when I opened the sandwich it was mostly all bread but very little of protein and vegetables and most of it just thick bread. The most of all the sandwich was smoke salmon which there was barely any salmon inside.. when I looked at it it was one thin slice of salmon and the rest was alot of creamchease and a bit veggies and very thick bread.. I usually if I get lux salmon smoke fish sandwich from other good places you can see its a good portion of salmon and veggies in the sandwich but in this place it's unbelievable...So, that was my last straw to decide if I want to come back. To my opinion the manager who is running this place based upon how the service is and the crazy rules on what customers ask for, should know, its not professional to run a...

   Read more
avatar
1.0
2y

Unorganized & Rude! 2 friends & I went in and ordered 2 desserts in the back, then we asked her for coffee and she said to go up front. I asked her if we needed to pay her since she was standing in front of a register. She said no pay up front. There wasn’t anyone on line so we walked up front to the coffee area & were standing there waiting to get coffee. After 5 minutes waiting we asked who can help us with coffee & was told to get in line to get it. We went the 3-steps back to the register & she was asking the lady if the creme brulee & tiramisu was hers & she said no. We said it was ours & that we wanted coffee also. The girl at the register said Oh well you have to get on line to pay. At this point there was now a very long line & more than 10 people on line. So we said we were on line and the man told us as well as the girl to get the coffee up front. She said to order the coffee here but you need to get online first again. I said or desserts already here waiting for us. Why can’t we just pay and get coffee and she said no. So the three of us walked out and didn’t get anything. Not sure if it was a language barrier, but the staff should communicate clearly, and guide customers who are new to this establishment! This was very unprofessional and the staff did not care about us as customers. How disappointing, because I will never come back...

   Read more
Page 1 of 7
Previous
Next

Posts

Your browser does not support the video tag.
itsyaboymikeofficialitsyaboymikeofficial
Where should I go next? #bestofnyc
Your browser does not support the video tag.
whatmakesamhappywhatmakesamhappy
Found this new hidden gem in Queens, NY called The French Workshop. Definitely my new go to cafe 😍 #ny #nyc #queens #food #foodie #foodtiktok #foodlover #cafe #newyork #coffee #foodcrawl #thefrenchworkshop
Your browser does not support the video tag.
foreignurforeignur
#pistachio #cremebrulee had to be the best one. #thefrenchworkshop #queensfood #fypă‚·
See more posts
See more posts
hotel
Find your stay

Pet-friendly Hotels in New York

Find a cozy hotel nearby and make it a full experience.

Where should I go next? #bestofnyc
itsyaboymikeofficial

itsyaboymikeofficial

hotel
Find your stay

Affordable Hotels in New York

Find a cozy hotel nearby and make it a full experience.

Get the Appoverlay
Get the AppOne tap to find yournext favorite spots!
Found this new hidden gem in Queens, NY called The French Workshop. Definitely my new go to cafe 😍 #ny #nyc #queens #food #foodie #foodtiktok #foodlover #cafe #newyork #coffee #foodcrawl #thefrenchworkshop
whatmakesamhappy

whatmakesamhappy

hotel
Find your stay

The Coolest Hotels You Haven't Heard Of (Yet)

Find a cozy hotel nearby and make it a full experience.

hotel
Find your stay

Trending Stays Worth the Hype in New York

Find a cozy hotel nearby and make it a full experience.

#pistachio #cremebrulee had to be the best one. #thefrenchworkshop #queensfood #fypă‚·
foreignur

foreignur

See more posts
See more posts